-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AURKC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AURKC (NP_001015878.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AURKC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AURKC (NP_001015878.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04169A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AURKC |
| Target Synonyms | AIE2; AIK3; ARK3; AurC; SPGF5; STK13; HEL-S-90; aurora-C; AURKC | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AURKC (NP_001015878.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQH | Uniprot ID | Q9UQB9 |
Uniprot Id
Q9UQB9
Target Species
Human
Target Name
AURKC
Target Full Name
Aurora kinase C
Target Function
Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Plays also a role in meiosis and more particularly in spermatogenesis. Has redundant cellular functions with AURKB and can rescue an AURKB knockdown. Like AURKB, AURKC phosphorylates histone H3 at 'Ser-10' and 'Ser-28'. AURKC phosphorylates the CPC complex subunits BIRC5/survivin and INCENP leading to increased AURKC activity. Phosphorylates TACC1, another protein involved in cell division, at 'Ser-228'.
Target Involvement
Spermatogenic failure 5 (SPGF5)
Target Subcellular Location
Nucleus. Chromosome. Chromosome, centromere. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, Aurora subfamily
Target Tissue Specificity
Isoform 1 and isoform 2 are expressed in testis. Elevated expression levels were seen only in a subset of cancer cell lines such as Hep-G2, Huh-7 and HeLa. Expression is maximum at M phase.
Target Synonyms
AURKC; AIE 2; Aie1; AIE2; AIK 3; AIK3; ARK 3; ARK-3; ARK3; Aur C; AurC; Aurkc; AURKC_HUMAN; aurora 3; Aurora C; Aurora kinase C; aurora related kinase 3; Aurora-related kinase 3; Aurora/Ipl1 related kinase 3; Aurora/Ipl1-related kinase 3; Aurora/Ipl1/Eg2 protein 2; EC 2.7.11.1; Serine threonine protein kinase 13; serine/threonine kinase 13 (aurora/IPL1 like); serine/threonine protein kinase aurora C; Serine/threonine-protein kinase 13; Serine/threonine-protein kinase aurora-C; SPGF5; STK13
Target Background
This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.
Notification