Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BCAP29 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-241 of human BCAP29 (NP_061332.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BCAP29 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-241 of human BCAP29 (NP_061332.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03080A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BCAP29 |
| Target Synonyms | B29; BAP29; BCAP29 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, ES-2, MCF7, Mouse brain, Mouse testis, SKOV3, SW480, THP-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 125-241 of human BCAP29 (NP_061332.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL | Uniprot ID | Q9UHQ4 |
Uniprot Id
Q9UHQ4
Target Species
Human
Target Name
BCAP29
Target Full Name
B-cell receptor-associated protein 29
Target Function
May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
BCAP29/BCAP31 family
Target Synonyms
BCAP29; BAP29; B-cell receptor-associated protein 29; BCR-associated protein 29; Bap29
Target Background
Involved in osteoblast differentiation. Located in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
