Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BTBD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human BTBD1 (NP_079514.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BTBD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human BTBD1 (NP_079514.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05234A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BTBD1 |
| Target Synonyms | C15orf1; NS5ATP8; BTBD1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human BTBD1 (NP_079514.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT | Uniprot ID | Q9H0C5 |
Uniprot Id
Q9H0C5
Target Species
Human
Target Name
BTBD1
Target Full Name
BTB/POZ domain-containing protein 1
Target Function
Probable substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to regulate expression levels and/or subnuclear distribution of TOP1, via an unknown mechanism. May play a role in mesenchymal differentiation where it promotes myogenic differentiation and suppresses adipogenesis.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Ubiquitous; highest levels in testes, heart and skeletal muscle.
Target Synonyms
BTBD1; C15orf1; NS5ATP8BTB/POZ domain-containing protein 1; Hepatitis C virus NS5A-transactivated protein 8; HCV NS5A-transactivated protein 8
Target Background
The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
