Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BTBD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 5-75 of human BTBD7 (NP_060637.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BTBD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 5-75 of human BTBD7 (NP_060637.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02428A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BTBD7 |
| Target Synonyms | FUP1; BTBD7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse testis, PC-3, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 5-75 of human BTBD7 (NP_060637.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASNYPHSCSPRVGGNSQAQQTFIGTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRTSGLATLKKKFIKRRK | Uniprot ID | Q9P203 |
Uniprot Id
Q9P203
Target Species
Human
Target Name
BTBD7
Target Full Name
BTB/POZ domain-containing protein 7
Target Function
Acts as a mediator of epithelial dynamics and organ branching by promoting cleft progression. Induced following accumulation of fibronectin in forming clefts, leading to local expression of the cell-scattering SNAIL2 and suppression of E-cadherin levels, thereby altering cell morphology and reducing cell-cell adhesion. This stimulates cell separation at the base of forming clefts by local, dynamic intercellular gap formation and promotes cleft progression.
Target Subcellular Location
Nucleus.
Target Synonyms
5730507E09Rik; 8030448M07; BTB (POZ) domain containing 7; BTB domain containing 7; BTB/POZ domain-containing protein 7; BTBD7; BTBD7_HUMAN; E130118E17Rik; FUP1; KIAA1525; mKIAA1525
Target Background
Predicted to be involved in regulation of branching involved in salivary gland morphogenesis. Predicted to be located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
