Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BUD31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human BUD31 (NP_003901.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BUD31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human BUD31 (NP_003901.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02241A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BUD31 |
| Target Synonyms | G10; EDG2; Cwc14; EDG-2; fSAP17; YCR063W; BUD31 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, Mouse brain, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human BUD31 (NP_003901.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG | Uniprot ID | P41223 |
Uniprot Id
P41223
Target Species
Human
Target Name
BUD31
Target Full Name
Protein BUD31 homolog
Target Function
Involved in the pre-mRNA splicing process. May play a role as regulator of AR transcriptional activity; may increase AR transcriptional activity.
Target Subcellular Location
Nucleus.
Target Protein Families
BUD31 (G10) family
Target Tissue Specificity
Detected in epithelial and stromal cells in benign prostate hyperplasia tissue (at protein level).
Target Synonyms
Bud31; BUD31 homolog (S. cerevisiae); BUD31_HUMAN; Cwc14; EDG 2; EDG2; fSAP17; Functional spliceosome associated protein 17; G10; G10 maternal transcript homolog; Maternal G10 transcript; Protein BUD31 homolog; Protein EDG-2; Protein G10 homolog; YCR063W
Target Background
Enables nuclear receptor binding activity and nuclear receptor coactivator activity. Involved in mRNA splicing, via spliceosome and positive regulation of androgen receptor activity. Located in nucleus. Part of U2-type catalytic step 2 spliceosome. Colocalizes with chromatin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
