-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cadherin 16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human Cadherin 16 (O75309) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Cadherin 16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human Cadherin 16 (O75309) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14233A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cadherin 16 |
| Target Synonyms | Ksp cadherin; Cadherin 16 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human Cadherin 16 (O75309). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAEGQIVLSGDSGKATEGPFAMDPDSGFLLVTRALDREEQAEYQLQVTLEMQDGHVLWGPQPVLVHVKDENDQVPHFSQAIYRARLSRGTRPGIPFLFLEASDRDEPGTANSDLRFHILSQAPAQPSPDMF | Uniprot ID | O75309 |
Uniprot Id
O75309
Target Species
Human
Target Name
CDH16
Target Full Name
Cadherin-16
Target Function
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Kidney specific.
Target Synonyms
CAD16_HUMAN; Cadherin 16; Cadherin 16 KSP cadherin; Cadherin kidney; Cadherin-16; CDH 16; CDH16; Kidney cadherin; Kidney specific cadherin; Kidney-specific cadherin; Ksp cadherin ; Ksp-cadherin; PRO1340; UNQ695
Target Background
This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. Mapped to a previously identified cluster of cadherin genes on chromosome 16q22.1, the gene localizes with superfamily members CDH1, CDH3, CDH5, CDH8 and CDH11. The protein consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development. Alternatively spliced transcript variants encoding distinct isoforms have been identified.
Notification