-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCL27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-112 of human CCL27 (NP_006655.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCL27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-112 of human CCL27 (NP_006655.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08902A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCL27 |
| Target Synonyms | ALP; ILC; CTAK; CTACK; PESKY; ESKINE; SCYA27; CCL27 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus, SKOV3, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-112 of human CCL27 (NP_006655.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG | Uniprot ID | Q9Y4X3 |
Uniprot Id
Q9Y4X3
Target Species
Human
Target Name
CCL27
Target Full Name
C-C motif chemokine 27
Target Function
Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine beta (chemokine CC) family
Target Tissue Specificity
Testis, thymus, placenta, ovary and skin.
Target Synonyms
ALP; C-C motif chemokine 27; CC chemokine ILC; Ccl27; CCL27_HUMAN; Chemokine (C-C motif) ligand 27; CTACK; CTAK; Cutaneous T cell attracting chemokine; Cutaneous T-cell-attracting chemokine; ESkine; IL 11 R alpha locus chemokine; IL-11 R-alpha-locus chemokine; ILC; PESKY; SCYA27; Skinkine; Small inducible cytokine A27 ; small inducible cytokine subfamily A (Cys-Cys); member 27; Small-inducible cytokine A27
Target Background
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation.
Notification