-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CD44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-17053A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD44 |
| Target Synonyms | IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1; 44 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HUVEC, Mouse spleen | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV | Uniprot ID | P16070 |
Uniprot Id
P16070
Target Species
Human
Target Name
CD44
Target Full Name
CD44 antigen
Target Function
Cell-surface receptor that plays a role in cell-cell interactions, cell adhesion and migration, helping them to sense and respond to changes in the tissue microenvironment. Participates thereby in a wide variety of cellular functions including the activation, recirculation and homing of T-lymphocytes, hematopoiesis, inflammation and response to bacterial infection. Engages, through its ectodomain, extracellular matrix components such as hyaluronan/HA, collagen, growth factors, cytokines or proteases and serves as a platform for signal transduction by assembling, via its cytoplasmic domain, protein complexes containing receptor kinases and membrane proteases. Such effectors include PKN2, the RhoGTPases RAC1 and RHOA, Rho-kinases and phospholipase C that coordinate signaling pathways promoting calcium mobilization and actin-mediated cytoskeleton reorganization essential for cell migration and adhesion.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, microvillus.
Target Tissue Specificity
Isoform 10 (epithelial isoform) is expressed by cells of epithelium and highly expressed by carcinomas. Expression is repressed in neuroblastoma cells.
Target Research Area
Immunology, Cancer
Target Synonyms
LHR; BA-1; CD 44; CD44; CD44 antigen; CD44 molecule (Indian blood group); CD44 molecule; CD44_HUMAN; CDw44; CDW44 antigen; Cell surface glycoprotein CD44; chondroitin sulfate proteoglycan 8; CSPG8; ECMR-III; Epican; Extracellular matrix receptor III; GP90 lymphocyte homing/adhesion receptor; HCELL; hematopoietic cell E- and L-selectin ligand; Heparan sulfate proteoglycan; Hermes antigen; homing function and Indian blood group system; HSA; HUTCH-I; HUTCH1; HUTCHI; Hyaluronate receptor; IN; INLU-related p80 Glycoprotein; MC56; MDU2; MDU3; MGC10468; MIC4; MUTCH I; MUTCH1; PGP-1; PGP-I; PGP1; Phagocytic glycoprotein 1; Phagocytic glycoprotein I; Soluble CD44
Target Background
The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.
Notification