-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDC34 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-236 of human CDC34 (NP_004350.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CDC34 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-236 of human CDC34 (NP_004350.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09689A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDC34 |
| Target Synonyms | UBC3; UBCH3; UBE2R1; E2-CDC34; CDC34 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Jurkat, Mouse testis, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-236 of human CDC34 (NP_004350.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES | Uniprot ID | P49427 |
Uniprot Id
P49427
Target Species
Human
Target Name
CDC34
Target Full Name
Ubiquitin-conjugating enzyme E2 R1
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Cooperates with the E2 UBCH5C and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Performs ubiquitin chain elongation building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. UBE2D3 acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Cooperates with the SCF(SKP2) E3 ligase complex to regulate cell proliferation through ubiquitination and degradation of MYBL2 and KIP1. Involved in ubiquitin conjugation and degradation of CREM isoform ICERIIgamma and ATF15 resulting in abrogation of ICERIIgamma- and ATF5-mediated repression of cAMP-induced transcription during both meiotic and mitotic cell cycles. Involved in the regulation of the cell cycle G2/M phase through its targeting of the WEE1 kinase for ubiquitination and degradation. Also involved in the degradation of beta-catenin. Is target of human herpes virus 1 protein ICP0, leading to ICP0-dependent dynamic interaction with proteasomes.
Target Subcellular Location
Cytoplasm. Nucleus. Note=The phosphorylation of the C-terminal tail plays an important role in mediating nuclear localization. Colocalizes with beta-tubulin on mitotic spindles in anaphase.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Expressed in testes during spermatogenesis to regulate repression of cAMP-induced transcription.
Target Synonyms
Cdc 34; Cdc34; Cell division cycle 34; Cell division cycle 34 homolog (S. cerevisiae); Cell division cycle 34 homolog; E2 CDC34; UB2R1_HUMAN; UBC 3; UBC3; UBCH3; UBE2 R1; UBE2R1; Ubiquitin carrier protein; Ubiquitin conjugating enzyme Cdc34; Ubiquitin conjugating enzyme E2 32 kDa complementing; Ubiquitin protein ligase; Ubiquitin protein ligase R1; Ubiquitin-conjugating enzyme E2 R1; Ubiquitin-conjugating enzyme E2-32 kDa complementing; Ubiquitin-conjugating enzyme E2-CDC34; Ubiquitin-protein ligase R1
Target Background
The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication.
Notification