-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDHR5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-220 of human CDHR5 (NP_112554.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDHR5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-220 of human CDHR5 (NP_112554.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10267A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDHR5 |
| Target Synonyms | MLPCDH; MUCDHL; MUPCDH; MU-PCDH; CDHR5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-220 of human CDHR5 (NP_112554.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QAQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFPFKTKEIRVEEDTKVNSTVIPETQLQAEDRDKDDILFYTLQEMTAGASDYFSLVSVNRPALRLDRPLDFYERPNMTFWLLVRDTPGENVEPSHTAT | Uniprot ID | Q9HBB8 |
Uniprot Id
Q9HBB8
Target Species
Human
Target Name
CDHR5
Target Full Name
Cadherin-related family member 5
Target Function
Intermicrovillar adhesion molecule that forms, via its extracellular domain, calcium-dependent heterophilic complexes with CDHR2 on adjacent microvilli. Thereby, controls the packing of microvilli at the apical membrane of epithelial cells. Through its cytoplasmic domain, interacts with microvillus cytoplasmic proteins to form the intermicrovillar adhesion complex/IMAC. This complex plays a central role in microvilli and epithelial brush border differentiation.
Target Subcellular Location
Apical cell membrane; Single-pass type I membrane protein. Cell projection, microvillus membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Highest expression in kidney, liver, colon and small intestine. In kidney, expressed apically along brush border of proximal convoluted tubule but not in cortical collecting ducts. Isoform 1 is expressed primarily in adult small intestine and colon. Isofo
Target Synonyms
Cadherin-related family member 5; Cdhr5; CDHR5_HUMAN; FLJ 20219; FLJ20219; MU-PCDH; Mu-protocadherin; MUCDHL; MUCDHL-ALT; MUCDHL-FL; Mucin and cadherin-like protein; mucin-like protocadherin
Target Background
This gene is a novel mucin-like gene that is a member of the cadherin superfamily. While encoding nonpolymorphic tandem repeats rich in proline, serine and threonine similar to mucin proteins, the gene also contains sequence encoding calcium-binding motifs found in all cadherins. The role of the hybrid extracellular region and the specific function of this protein have not yet been determined. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification