-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-346 of human CDK7 (NP_001790.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CDK7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-346 of human CDK7 (NP_001790.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03343A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK7 |
| Target Synonyms | CAK; CAK1; HCAK; MO15; STK1; CDKN7; p39MO15; CDK7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, SW620 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 211-346 of human CDK7 (NP_001790.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF | Uniprot ID | P50613 |
Uniprot Id
P50613
Target Species
Human
Target Name
CDK7
Target Full Name
Cyclin-dependent kinase 7
Target Function
Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, perinuclear region.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Target Tissue Specificity
Ubiquitous.
Target Research Area
Cell Biology
Target Synonyms
39 kDa protein kinase; CAK; CAK1; Cdk activating kinase; CDK-activating kinase 1; CDK-activating kinase; cdk7; CDK7_HUMAN; CDKN7; Cell division protein kinase 7; Cyclin dependent kinase 7; cyclin-dependent kinase 7 (MO15 homolog; Xenopus laevis; cdk-activating kinase); Cyclin-dependent kinase 7; HCAK; Homolog of Xenopus MO15 Cdk activating kinase; Kinase subunit of CAK; MO15; MO15; Xenopus; homolog of; P39 Mo15; p39MO15; Serine threonine kinase Stk1; Serine/threonine protein kinase 1; Serine/threonine protein kinase MO15; STK1; TFIIH basal transcription factor complex kinase subunit
Target Background
The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.
Notification