Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDKL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKL3 (NP_001107047) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CDKL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKL3 (NP_001107047) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06798A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDKL3 |
| Target Synonyms | NKIAMRE; CDKL3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, LO2, Mouse brain, Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKL3 (NP_001107047). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNN | Uniprot ID | Q8IVW4 |
Uniprot Id
Q8IVW4
Target Species
Human
Target Name
CDKL3
Target Full Name
Cyclin-dependent kinase-like 3
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Target Synonyms
CDKL3; CDKL3 protein; CDKL3_HUMAN; Cyclin dependent kinase like 3; Cyclin-dependent kinase-like 3; Serine/threonine-protein kinase NKIAMRE
Target Background
The protein encoded by this gene is a member of cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This gene was identified as a gene absent in leukemic patients with chromosome 5q deletion. This loss may be an important determinant of dysmyelopoiesis. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
