-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CELF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 422-521 of human CELF2 (NP_006552.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CELF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 422-521 of human CELF2 (NP_006552.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03605A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CELF2 |
| Target Synonyms | ETR3; DEE97; ETR-3; NAPOR; CELF-2; CUGBP2; BRUNOL3; CUG-BP2; CELF2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 422-521 of human CELF2 (NP_006552.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY | Uniprot ID | O95319 |
Uniprot Id
O95319
Target Species
Human
Target Name
CELF2
Target Full Name
CUGBP Elav-like family member 2
Target Function
RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of TNNT2 in embryonic, but not adult, skeletal muscle. Activates TNNT2 exon 5 inclusion by antagonizing the repressive effect of PTB. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs. Promotes inclusion of exonS 21 and exclusion of exon 5 of the NMDA receptor R1 pre-mRNA. Involved in the apoB RNA editing activity. Increases COX2 mRNA stability and inhibits COX2 mRNA translation in epithelial cells after radiation injury. Modulates the cellular apoptosis program by regulating COX2-mediated prostaglandin E2 (PGE2) expression. Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK. Binds to the muscle-specific splicing enhancer (MSE) intronic sites flanking the TNNT2 alternative exon 5. Binds preferentially to UG-rich sequences, in particular UG repeat and UGUU motifs. Binds to apoB mRNA, specifically to AU-rich sequences located immediatly upstream of the edited cytidine. Binds AU-rich sequences in the 3'-UTR of COX2 mRNA. Binds to an intronic RNA element responsible for the silencing of exon 21 splicing. Binds to (CUG)n repeats. May be a specific regulator of miRNA biogenesis. Binds to primary microRNA pri-MIR140 and, with CELF1, negatively regulates the processing to mature miRNA.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
CELF/BRUNOL family
Target Tissue Specificity
Expressed in frontal cortex. Isoform 1 is expressed in brain and lung. Isoform 2 is expressed in heart, brain, placenta, lung, liver, kidney, skeletal muscle and pancreas. Isoform 4 is expressed in heart, lung, skeletal muscle, kidney and pancreas.
Target Synonyms
Bruno-like protein 3; BRUNOL3; Cardiac elav type RNA binding protein; CELF-2; celf2; CELF2_HUMAN; CUG BP2; CUG triplet repeat RNA-binding protein 2; CUG-BP- and ETR-3-like factor 2; CUG-BP2; CUGBP Elav like family member 2; CUGBP Elav-like family member 2; CUGBP2; dJ323N1.1; elav type RNA binding protein; ELAV-type RNA-binding protein 3; ETR 3; ETR-3; ETR3; HGNC:2550; hNAPOR; NAPOR 2; NAPOR; Neuroblastoma apoptosis-related RNA-binding protein; Neuroplastoma apoptosis related RNA binding protein 3; RNA binding protein BRUNOL3 ; RNA-binding protein BRUNOL-3
Target Background
Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification