-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CFHR5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-569 of human CFHR5 (NP_110414.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CFHR5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-569 of human CFHR5 (NP_110414.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01455A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CFHR5 |
| Target Synonyms | FHR5; CFHL5; FHR-5; CFHR5D; CFHR5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, K-562, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 450-569 of human CFHR5 (NP_110414.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPPPSINNGDTTSFPLSVYPPGSTVTYRCQSFYKLQGSVTVTCRNKQWSEPPRCLDPCVVSEENMNKNNIQLKWRNDGKLYAKTGDAVEFQCKFPHKAMISSPPFRAICQEGKFEYPICE | Uniprot ID | Q9BXR6 |
Uniprot Id
Q9BXR6
Target Species
Human
Target Name
CFHR5
Target Full Name
Complement factor H-related protein 5
Target Function
Involved in complement regulation. The dimerized forms have avidity for tissue-bound complement fragments and efficiently compete with the physiological complement inhibitor CFH.
Target Involvement
CFHR5 deficiency (CFHR5D)
Target Subcellular Location
Secreted.
Target Tissue Specificity
Expressed by the liver and secreted in plasma.
Target Synonyms
CFHL5; CFHR5; CFHR5D; Complement factor H-related 5; Complement factor H-related protein 5; factor H-related gene 5; factor H-related protein 5; FHR-5; FHR5; FHR5_HUMAN; FLJ10549; MGC133240; OTTHUMP00000034672
Target Background
This gene is a member of a small complement factor H (CFH) gene cluster on chromosome 1. Each member of this gene family contains multiple short consensus repeats (SCRs) typical of regulators of complement activation. The protein encoded by this gene has nine SCRs with the first two repeats having heparin binding properties, a region within repeats 5-7 having heparin binding and C reactive protein binding properties, and the C-terminal repeats being similar to a complement component 3 b (C3b) binding domain. This protein co-localizes with C3, binds C3b in a dose-dependent manner, and is recruited to tissues damaged by C-reactive protein. Allelic variations in this gene have been associated, but not causally linked, with two different forms of kidney disease: membranoproliferative glomerulonephritis type II (MPGNII) and hemolytic uraemic syndrome (HUS).
Notification