-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CFL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human CFL2 (NP_068733.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CFL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human CFL2 (NP_068733.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01824A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CFL2 |
| Target Synonyms | NEM7; CFL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, Rat brain, A-549, Mouse skeletal muscle, NCI-H460, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human CFL2 (NP_068733.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL | Uniprot ID | Q9Y281 |
Uniprot Id
Q9Y281
Target Species
Human
Target Name
CFL2
Target Full Name
Cofilin-2
Target Function
Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere.
Target Involvement
Nemaline myopathy 7 (NEM7)
Target Subcellular Location
Nucleus matrix. Cytoplasm, cytoskeleton.
Target Protein Families
Actin-binding proteins ADF family
Target Tissue Specificity
Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
Target Research Area
Signal Transduction
Target Synonyms
CFL 2; CFL2; COF2_HUMAN; Cofilin 2 muscle; Cofilin; Cofilin muscle; Cofilin muscle isoform; Cofilin-2; Cofilin2; muscle isoform; NEM 7; NEM7
Target Background
This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
Notification