Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against cFLIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-240 of human cFLIP (NP_003870.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against cFLIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-240 of human cFLIP (NP_003870.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08633A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | cFLIP |
| Target Synonyms | CASH; FLIP; MRIT; CLARP; FLAME; cFLIP; Casper; FLAME1; c-FLIP; FLAME-1; I-FLICE; c-FLIPL; c-FLIPR; c-FLIPS; CASP8AP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Jurkat, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-240 of human cFLIP (NP_003870.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP | Uniprot ID | O15519 |
Uniprot Id
O15519
Target Species
Human
Target Name
CFLAR
Target Full Name
CASP8 and FADD-like apoptosis regulator
Target Function
Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.
Target Protein Families
Peptidase C14A family
Target Tissue Specificity
Widely expressed. Higher expression in skeletal muscle, pancreas, heart, kidney, placenta, and peripheral blood leukocytes. Also detected in diverse cell lines. Isoform 8 is predominantly expressed in testis and skeletal muscle.
Target Synonyms
c FLIP; c FLIPL; c FLIPR; c FLIPS; c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8 and FADD like apoptosis regulator; CASP8 and FADD-like apoptosis regulator subunit p12; CASP8AP1; Caspase homolog; Caspase like apoptosis regulatory protein; Caspase related inducer of apoptosis; Caspase-eight-related protein; Caspase-like apoptosis regulatory protein; Casper; cellular flice inhibitory protein; Cellular FLICE-like inhibitory protein; CFLA; Cflar; CFLAR_HUMAN; CLARP; FADD like anti apoptotic molecule; FADD-like antiapoptotic molecule 1; FLAME; FLAME-1; FLAME1; FLIP; I FLICE; I-FLICE; Inhibitor of FLICE; MACH-related inducer of toxicity; MRIT; OTTHUMP00000163715; OTTHUMP00000206475; OTTHUMP00000206476; OTTHUMP00000206478; OTTHUMP00000206479; OTTHUMP00000206480; OTTHUMP00000206482; OTTHUMP00000207360; Usurpin; Usurpin beta
Target Background
The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
