Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHCHD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human CHCHD7 (NP_077276.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CHCHD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human CHCHD7 (NP_077276.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07300A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHCHD7 |
| Target Synonyms | COX23; CHCHD7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human CHCHD7 (NP_077276.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHQTRTGKKTVRMPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY | Uniprot ID | Q9BUK0 |
Uniprot Id
Q9BUK0
Target Species
Human
Target Name
CHCHD7
Target Full Name
Coiled-coil-helix-coiled-coil-helix domain-containing protein 7
Target Involvement
A chromosomal aberration involving CHCHD7 is found in salivary gland pleiomorphic adenomas, the most common benign epithelial tumors of the salivary gland. Translocation t(6;8)(p21.3-22;q13) with PLAG1.
Target Subcellular Location
Mitochondrion intermembrane space.
Target Protein Families
CHCHD7 family
Target Synonyms
CHCHD7Coiled-coil-helix-coiled-coil-helix domain-containing protein 7
Target Background
Predicted to be located in mitochondrial intermembrane space.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
