Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHPT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHPT1 (NP_064629.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHPT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHPT1 (NP_064629.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09998A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHPT1 |
| Target Synonyms | CPT; CPT1; CHPT1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHPT1 (NP_064629.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAGAGAGSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLC | Uniprot ID | Q8WUD6 |
Uniprot Id
Q8WUD6
Target Species
Human
Target Name
CHPT1
Target Full Name
Cholinephosphotransferase 1
Target Function
Catalyzes phosphatidylcholine biosynthesis from CDP-choline. It thereby plays a central role in the formation and maintenance of vesicular membranes.
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Target Tissue Specificity
Highly expressed in testis, colon, small intestine, heart, prostate and spleen. Also detected in kidney, skeletal muscle, pancreas, leukocytes, ovary and thymus. Weakly expressed in the brain, placenta and lung. Overexpressed in cancerous breast epithelia
Target Synonyms
CHPT1; CPT1; MSTP022; Cholinephosphotransferase 1; hCPT1; EC 2.7.8.2; AAPT1-like protein; Diacylglycerol cholinephosphotransferase 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
