Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CIR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human CIR1 (NP_004873.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CIR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human CIR1 (NP_004873.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01290A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CIR1 |
| Target Synonyms | CIR; CIR1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U2OS | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human CIR1 (NP_004873.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDG | Uniprot ID | Q86X95 |
Uniprot Id
Q86X95
Target Species
Human
Target Name
CIR1
Target Full Name
Corepressor interacting with RBPJ 1
Target Function
May modulate splice site selection during alternative splicing of pre-mRNAs. Regulates transcription and acts as corepressor for RBPJ. Recruits RBPJ to the Sin3-histone deacetylase complex (HDAC). Required for RBPJ-mediated repression of transcription.
Target Subcellular Location
Nucleus speckle. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Note=Colocalizes with NEK6 in the centrosome.
Target Tissue Specificity
Highly expressed in heart, brain, placenta, liver, skeletal muscle and pancreas.
Target Synonyms
CIR1; CIRCorepressor interacting with RBPJ 1; CBF1-interacting corepressor; Recepin
Target Background
Enables histone deacetylase binding activity; protein kinase binding activity; and transcription corepressor activity. Acts upstream of or within negative regulation of transcription by RNA polymerase II. Located in nuclear speck. Part of protein-containing complex. Colocalizes with centrosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
