Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLEC2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human CLEC2B (NP_005118.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLEC2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human CLEC2B (NP_005118.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01724A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLEC2B |
| Target Synonyms | AICL; IFNRG1; CLECSF2; HP10085; CLEC2B | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human CLEC2B (NP_005118.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGS | Uniprot ID | Q92478 |
Uniprot Id
Q92478
Target Species
Human
Target Name
CLEC2B
Target Full Name
C-type lectin domain family 2 member B
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Tissue Specificity
Expressed preferentially in lymphoid tissues, and in most hematopoietic cell types.
Target Synonyms
CLEC2B; AICL; CLECSF2; IFNRG1C-type lectin domain family 2 member B; Activation-induced C-type lectin; C-type lectin superfamily member 2; IFN-alpha-2b-inducing-related protein 1
Target Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
