-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLEC2D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-154 of human CLEC2D (NP_037401.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLEC2D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-154 of human CLEC2D (NP_037401.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09064A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLEC2D |
| Target Synonyms | CLAX; LLT1; OCIL; CLEC2D | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HL-60, LO2, Raji, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-154 of human CLEC2D (NP_037401.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ | Uniprot ID | Q9UHP7 |
Uniprot Id
Q9UHP7
Target Species
Human
Target Name
CLEC2D
Target Full Name
C-type lectin domain family 2 member D
Target Function
Receptor for KLRB1 that protects target cells against natural killer cell-mediated lysis. Inhibits osteoclast formation. Inhibits bone resorption. Modulates the release of interferon-gamma. Binds high molecular weight sulfated glycosaminoglycans.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Isoform 2]: Endoplasmic reticulum.; [Isoform 4]: Endoplasmic reticulum.
Target Tissue Specificity
Detected in peripheral blood leukocytes, osteoblasts, lymph node, thymus and spleen. Isoform 1, isoform 2 and isoform 4 are expressed in T- and B-lymphocytes, and at lower levels in NK cells. They are also expressed in B-cell lines and LPS-matured monocyt
Target Synonyms
C type lectin related f; C type lectin superfamily 2; member D; C-type lectin domain family 2 member D; CLAX; CLC2D_HUMAN; CLEC2D; CLEC2D protein; Clec2d5 ; L LT1; Lectin like NK cell receptor ; Lectin like transcript 1; Lectin-like NK cell receptor; Lectin-like transcript 1; LLT-1; LLT1; OCIL; Osteoclast inhibitory lectin
Target Background
This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene.
Notification