Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNTN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human CNTN3 (NP_065923.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CNTN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human CNTN3 (NP_065923.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05468A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNTN3 |
| Target Synonyms | PCS; PANG; BIG-1; CNTN3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human CNTN3 (NP_065923.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHYRWQLNGSDIDMSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIV | Uniprot ID | Q9P232 |
Uniprot Id
Q9P232
Target Species
Human
Target Name
CNTN3
Target Full Name
Contactin-3
Target Function
Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Immunoglobulin superfamily, Contactin family
Target Tissue Specificity
In brain, it is expressed in frontal lobe, occipital lobe, cerebellum and amygdala.
Target Synonyms
BIG 1; BIG-1; Brain derived immunoglobulin superfamily protein 1; Brain-derived immunoglobulin superfamily protein 1; Cntn3; CNTN3_HUMAN; Contactin 3; Contactin-3; KIAA1496; PANG; PCS; Plasmacytoma-associated neuronal glycoprotein
Target Background
Predicted to be involved in cell adhesion and nervous system development. Predicted to be located in extracellular region and plasma membrane. Predicted to be active in neuron projection.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
