-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSF2RA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CSF2RA (NP_001155001.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against CSF2RA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CSF2RA (NP_001155001.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-04167A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSF2RA |
| Target Synonyms | GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha; CSF2RA | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CSF2RA (NP_001155001.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQY | Uniprot ID | P15509 |
Uniprot Id
P15509
Target Species
Human
Target Name
CSF2RA
Target Full Name
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
Target Function
Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
Target Involvement
Pulmonary surfactant metabolism dysfunction 4 (SMDP4)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.; [Isoform 6]: Secreted.
Target Protein Families
Type I cytokine receptor family, Type 5 subfamily
Target Research Area
Immunology
Target Synonyms
CD_antigen=CD116; CD116; CD116 antigen; CDw116; Colony stimulating factor 2 receptor alpha chain; Colony stimulating factor 2 receptor alpha low affinity; Colony stimulating factor 2 receptor alpha subunit; CSF 2R; CSF2R; CSF2R_HUMAN; CSF2RA; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM CSF R alpha; GM CSF receptor alpha subunit; GM-CSF-R-alpha; GMCSFR; GMCSFR-alpha; GMR-alpha; Granulocyte macrophage colony stimulating factor receptor alpha chain; Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; SMDP4
Target Background
The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble.
Notification