-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CTGF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CTGF (NP_001892.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CTGF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CTGF (NP_001892.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12988A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ctgf |
| Target Synonyms | CTGF; NOV2; HCS24; IGFBP8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CTGF (NP_001892.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCL | Uniprot ID | P29279 |
Uniprot Id
P29279
Target Species
Human
Target Name
CCN2
Target Full Name
CCN family member 2
Target Function
Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted.
Target Protein Families
CCN family
Target Tissue Specificity
Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested.
Target Research Area
Immunology, Cardiovascular
Target Synonyms
CCN 2; CCN family member 2; CCN2; Connective tissue growth factor; Ctgf; CTGF_HUMAN; Hcs 24; Hcs24; Hypertrophic chondrocyte specific protein 24; Hypertrophic chondrocyte-specific gene product 24 ; Hypertrophic chondrocyte-specific protein 24; IBP-8; IGF-binding protein 8; IGFBP-8; IGFBP8; Insulin like Growth Factor Binding Protein 8; Insulin-like growth factor-binding protein 8; MGC102839; NOV 2; NOV2
Target Background
The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis.
Notification