Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDX25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 284-483 of human DDX25 (NP_037396.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DDX25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 284-483 of human DDX25 (NP_037396.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04810A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDX25 |
| Target Synonyms | GRTH; DDX25 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse eye, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 284-483 of human DDX25 (NP_037396.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMDEIEKIDY | Uniprot ID | Q9UHL0 |
Uniprot Id
Q9UHL0
Target Species
Human
Target Name
DDX25
Target Full Name
ATP-dependent RNA helicase DDX25
Target Function
ATP-dependent RNA helicase. Required for mRNA export and translation regulation during spermatid development.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
DEAD box helicase family
Target Tissue Specificity
Highly expressed in the Leydig and germ cells of the testis and weakly expressed in the pituitary and hypothalamus.
Target Synonyms
DDX25; GRTHATP-dependent RNA helicase DDX25; EC 3.6.4.13; DEAD box protein 25; Gonadotropin-regulated testicular RNA helicase
Target Background
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The encoded protein is a gonadotropin-regulated and developmentally expressed testicular RNA helicase. It may serve to maintain testicular functions related to steroidogenesis and spermatogenesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
