-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DEAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 426-565 of human DEAF1 (NP_066288.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DEAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 426-565 of human DEAF1 (NP_066288.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06842A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DEAF1 |
| Target Synonyms | SPN; NUDR; VSVS; MRD24; ZMYND5; NEDHELS; DEAF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, HT-29, Mouse lung, Mouse pancreas, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 426-565 of human DEAF1 (NP_066288.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LAVPPPTPTKAAPPALVNGLELSEPRSWLYLEEMVNSLLNTAQQLKTLFEQAKHASTYREAATNQAKIHADAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVTV | Uniprot ID | O75398 |
Uniprot Id
O75398
Target Species
Human
Target Name
DEAF1
Target Full Name
Deformed epidermal autoregulatory factor 1 homolog
Target Function
Transcription factor that binds to sequence with multiple copies of 5'-TTC[CG]G-3' present in its own promoter and that of the HNRPA2B1 gene. Down-regulates transcription of these genes. Binds to the retinoic acid response element (RARE) 5'-AGGGTTCACCGAAAGTTCA-3'. Activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase. Required for neural tube closure and skeletal patterning. Regulates epithelial cell proliferation and side-branching in the mammary gland. Controls the expression of peripheral tissue antigens in pancreatic lymph nodes. Isoform 1 displays greater transcriptional activity than isoform 4. Isoform 4 may inhibit transcriptional activity of isoform 1 by interacting with isoform 1 and retaining it in the cytoplasm. Transcriptional activator of EIF4G3.
Target Involvement
Mental retardation, autosomal dominant 24 (MRD24); Dyskinesia, seizures, and intellectual developmental disorder (DYSEIDD)
Target Subcellular Location
[Isoform 1]: Nucleus. Cytoplasm. Note=Cytoplasmic in non-mucinous colorectal carcinoma. When expressed alone, localized almost exclusively in the nucleus but, when expressed with isoform 4, nuclear expression decreases to 32% and cytoplasmic expression increases by 270%.; [Isoform 2]: Secreted. Note=Secreted in some cell types.; [Isoform 3]: Secreted. Note=Secreted in some cell types.; [Isoform 4]: Cytoplasm. Nucleus. Note=When expressed alone, localizes mainly in the cytoplasm but, when expressed with isoform 1, nuclear localization is enhanced.
Target Tissue Specificity
Expressed in various tissues and cells such as in peripheral mononuclear cells and hormone-secreting pituitary cells. Expression in pancreatic lymph nodes of patients with type 1 diabetes is 20 times higher than in healthy controls. Highly expressed in fe
Target Synonyms
Deaf1; DEAF1 transcription factor; DEAF1_HUMAN; Deformed epidermal autoregulatory factor 1 homolog; Nuclear DEA1 related transcriptional regulator; Nuclear DEAF-1-related transcriptional regulator; NUDR; SPN; Suppressin; Zinc finger MYND domain containing protein 5; Zinc finger MYND domain-containing protein 5; ZMYND5
Target Background
This gene encodes a zinc finger domain-containing protein that functions as a regulator of transcription. The encoded proteins binds to its own promoter as well as to that of several target genes. Activity of this protein is important in the regulation of embryonic development. Mutations in this gene have been found in individuals with autosomal dominant cognitive disability. Alternative splicing results in multiple transcript variants.
Notification