Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DECR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human DECR2 (NP_065715.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DECR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human DECR2 (NP_065715.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07009A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DECR2 |
| Target Synonyms | PDCR; SDR17C1; DECR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human DECR2 (NP_065715.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLG | Uniprot ID | Q9NUI1 |
Uniprot Id
Q9NUI1
Target Species
Human
Target Name
DECR2
Target Full Name
Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]
Target Function
Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.
Target Subcellular Location
Peroxisome.
Target Protein Families
Short-chain dehydrogenases/reductases (SDR) family, 2,4-dienoyl-CoA reductase subfamily
Target Synonyms
2 4 dienoyl CoA reductase 2; 2 4 dienoyl CoA reductase 2 peroxisomal; 2; 4-dienoyl-CoA reductase 2; 4-dienoyl-CoA reductase; DECR 2; Decr2; DECR2_HUMAN; EC 1.3.1.34; pDCR; Peroxisomal 2 4 dienoyl CoA reductase; Peroxisomal 2; SDR17C1; Short chain dehydrogenase/reductase family 17C member 1
Target Background
Enables 2, 4-dienoyl-CoA reductase (NADPH) activity and trans-2-enoyl-CoA reductase (NADPH) activity. Involved in unsaturated fatty acid biosynthetic process. Predicted to be located in peroxisome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
