-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DEK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human DEK (NP_003463.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DEK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human DEK (NP_003463.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03628A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DEK |
| Target Synonyms | D6S231E; DEK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human DEK (NP_003463.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KSLIVEGKREKKKVERLTMQVSSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTVSSLKKNVGQFSGFPFEKGSVQYKKKEEMLKKFRNAMLKSI | Uniprot ID | P35659 |
Uniprot Id
P35659
Target Species
Human
Target Name
DEK
Target Full Name
Protein DEK
Target Function
Involved in chromatin organization.
Target Involvement
A chromosomal aberration involving DEK is found in a subset of acute myeloid leukemia (AML); also known as acute non-lymphocytic leukemia (PubMed:1549122). Translocation t(6;9)(p23;q34) with NUP214/CAN (PubMed:1549122). It results in the formation of a DEK-NUP214 fusion gene (PubMed:1549122).
Target Subcellular Location
Nucleus. Note=Enriched in regions where chromatin is decondensed or sparse in the interphase nuclei.
Target Tissue Specificity
Ubiquitous. Expressed at relatively high levels.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
D6S231E; Dek; DEK gene; DEK oncogene; DEK oncogene DNA binding; DEK_HUMAN; Protein DEK
Target Background
This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene, and the presence of antibodies against this protein are all associated with various diseases. Two transcript variants encoding different isoforms have been found for this gene.
Notification