-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DPF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human DPF2 (NP_006259.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DPF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human DPF2 (NP_006259.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04377A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DPF2 |
| Target Synonyms | REQ; CSS7; UBID4; ubi-d4; SMARCG2; DPF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse testis, Mouse thymus, Rat lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human DPF2 (NP_006259.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDAS | Uniprot ID | Q92785 |
Uniprot Id
Q92785
Target Species
Human
Target Name
DPF2
Target Full Name
Zinc finger protein ubi-d4
Target Function
Plays an active role in transcriptional regulation by binding modified histones H3 and H4. Is a negative regulator of myeloid differentiation of hematopoietic progenitor cells. Might also have a role in the development and maturation of lymphoid cells. Involved in the regulation of non-canonical NF-kappa-B pathway.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Requiem/DPF family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Apoptosis response zinc finger protein; BAF45D; BRG1-associated factor 45D; D4; D4 zinc and double PHD fingers family 2; Double PHD fingers 2; double PHD fingers family 2; DPF 2; DPF2; MGC10180; Protein requiem; REQ; REQU_HUMAN; Requiem; Requiem apoptosis response zinc finger; UBI D4; ubi-d4; UBID 4; UBID4; zinc and double PHD fingers family 2; Zinc finger protein ubi d4; Zinc finger protein ubi-d4
Target Background
The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors.
Notification