-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DPYSL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 440-520 of human DPYSL3 (NP_001378.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DPYSL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 440-520 of human DPYSL3 (NP_001378.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02286A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DPYSL3 |
| Target Synonyms | DRP3; ULIP; CRMP4; DRP-3; LCRMP; CRMP-4; ULIP-1; DPYSL3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 440-520 of human DPYSL3 (NP_001378.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSAR | Uniprot ID | Q14195 |
Uniprot Id
Q14195
Target Species
Human
Target Name
DPYSL3
Target Full Name
Dihydropyrimidinase-related protein 3
Target Function
Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration.
Target Subcellular Location
Cytoplasm. Cell projection, growth cone.
Target Protein Families
Metallo-dependent hydrolases superfamily, Hydantoinase/dihydropyrimidinase family
Target Tissue Specificity
Mainly expressed in heart and skeletal muscle. Also strongly expressed in fetal brain and spinal cord.
Target Research Area
Neuroscience
Target Synonyms
Collapsin response mediator protein 4; Collapsin response mediator protein 4 long; CRMP 4; CRMP-4; CRMP4; Dihydropyrimidinase like 3; Dihydropyrimidinase related protein 3; Dihydropyrimidinase-related protein 3; DPYL3_HUMAN; DPYSL3; DRP 3; DRP-3; DRP3; LCRMP; TUC4; ULIP 1; ULIP; ULIP-1; ULIP1; UNc 33 like phosphoprotein 1; Unc 33 like phosphoprotein; Unc-33-like phosphoprotein 1
Target Background
Enables filamin binding activity. Predicted to be involved in several processes, including actin filament organization; regulation of plasma membrane bounded cell projection organization; and response to axon injury. Predicted to act upstream of or within nervous system development. Predicted to be located in several cellular components, including cell body; growth cone; and lamellipodium. Predicted to be part of filamentous actin. Predicted to be active in synapse. Predicted to colocalize with exocytic vesicle.
Notification