-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DRAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human DRAP1 (NP_006433.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DRAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human DRAP1 (NP_006433.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06973A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DRAP1 |
| Target Synonyms | NC2-alpha; DRAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human DRAP1 (NP_006433.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTD | Uniprot ID | Q14919 |
Uniprot Id
Q14919
Target Species
Human
Target Name
DRAP1
Target Full Name
Dr1-associated corepressor
Target Function
The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own.
Target Subcellular Location
Nucleus.
Target Protein Families
NC2 alpha/DRAP1 family
Target Tissue Specificity
Ubiquitous. Highly expressed in adult testis, heart, skeletal muscle, pancreas and brain, and in fetal brain, liver and kidney.
Target Research Area
Transcription
Target Synonyms
DR1 associated corepressor; DR1 associated protein 1 (negative cofactor 2 alpha); DR1 associated protein 1; DR1 associated protein1; Dr1-associated corepressor; Dr1-associated protein 1; DRAP 1; Drap1; NC 2 alpha; NC 2alpha; NC2 alpha; NC2-alpha; NC2A_HUMAN; Negative co-factor 2-alpha; Negative cofactor 2 alpha; Negative cofactor 2alpha
Target Background
Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex.
Notification