Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DUSP14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DUSP14 (NP_008957.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DUSP14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DUSP14 (NP_008957.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06451A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DUSP14 |
| Target Synonyms | MKP6; MKP-L; DUSP14 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, BT-474, Mouse brain, SKOV3, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DUSP14 (NP_008957.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI | Uniprot ID | O95147 |
Uniprot Id
O95147
Target Species
Human
Target Name
DUSP14
Target Full Name
Dual specificity protein phosphatase 14
Target Function
Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Target Research Area
Signal Transduction
Target Synonyms
Dual specificity phosphatase 14; Dual specificity protein phosphatase 14; DUS14_HUMAN; DUSP 14; DUSP14; DUSP14 protein; MAP kinase phosphatase 6; Mitogen activated protein kinase phosphatase 6; Mitogen-activated protein kinase phosphatase 6; MKP 1 like protein tyrosine phosphatase; MKP 6; MKP L; MKP-1-like protein tyrosine phosphatase; MKP-6; MKP-L; MKP1 like protein tyrosine phosphatase; MKP6; MKPL
Target Background
Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
