Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DUSP22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human DUSP22 (NP_064570.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DUSP22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human DUSP22 (NP_064570.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02594A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DUSP22 |
| Target Synonyms | VHX; JKAP; JSP1; MKPX; JSP-1; MKP-x; LMWDSP2; LMW-DSP2; DUSP22 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human DUSP22 (NP_064570.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL | Uniprot ID | Q9NRW4 |
Uniprot Id
Q9NRW4
Target Species
Human
Target Name
DUSP22
Target Full Name
Dual specificity protein phosphatase 22
Target Function
Activates the Jnk signaling pathway.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Target Tissue Specificity
Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.
Target Research Area
Cell Biology
Target Synonyms
Dual specificity protein phosphatase 22; DUS22_HUMAN; Dusp22; JNK stimulatory phosphatase 1; JNK-stimulatory phosphatase-1; JSP 1; JSP-1; JSP1; LMW DSP2; LMW-DSP2; Low molecular weight dual specificity phosphatase 2; MAP kinase phosphatase x; Mitogen activated protein kinase phosphatase x; Mitogen-activated protein kinase phosphatase x; MKP-x; MKPX
Target Background
Enables non-membrane spanning protein tyrosine phosphatase activity and protein tyrosine kinase binding activity. Involved in several processes, including cellular response to epidermal growth factor stimulus; negative regulation of focal adhesion assembly; and negative regulation of non-membrane spanning protein tyrosine kinase activity. Acts upstream of or within negative regulation of transcription by RNA polymerase II. Located in plasma membrane. Part of cytoplasm; filamentous actin; and leading edge of lamellipodium.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
