Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DYNC1LI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 328-492 of human DYNC1LI2 (NP_006132.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DYNC1LI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 328-492 of human DYNC1LI2 (NP_006132.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07488A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DYNC1LI2 |
| Target Synonyms | LIC2; DNCLI2; DYNC1LI2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse testis, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 328-492 of human DYNC1LI2 (NP_006132.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIKNNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTENEA | Uniprot ID | O43237 |
Uniprot Id
O43237
Target Species
Human
Target Name
DYNC1LI2
Target Full Name
Cytoplasmic dynein 1 light intermediate chain 2
Target Function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in binding dynein to membranous organelles or chromosomes.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Dynein light intermediate chain family
Target Synonyms
Cytoplasmic dynein 1 light intermediate chain 2; cytosolic; DC1L2_HUMAN; DNCLI2; Dync1li2; Dynein cytoplasmic 1 light intermediate chain 2; Dynein light intermediate chain 2; dynein light intermediate chain 2 cytosolic; dynein; cytoplasmic; light intermediate polypeptide 2; LIC-2; LIC2; LIC53/55; OTTHUMP00000174820
Target Background
Cytoplasmic dynein is a microtubule-associated motor protein (Hughes et al., 1995 [PubMed 7738094]). See DYNC1H1 (MIM 600112) for general information about dyneins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
