-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eEF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 759-858 of human eEF2 (P13639) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against eEF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 759-858 of human eEF2 (P13639) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16721A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EEF2 |
| Target Synonyms | EF2; EF-2; EEF-2; SCA26; eEF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Jurkat, Mouse liver, Rat spleen | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 759-858 of human eEF2 (P13639). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL | Uniprot ID | P13639 |
Uniprot Id
P13639
Target Species
Human
Target Name
EEF2
Target Full Name
Elongation factor 2
Target Function
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
Target Involvement
Spinocerebellar ataxia 26 (SCA26)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, EF-G/EF-2 subfamily
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
EEF 2; Eef2; EF-2; EF2; EF2_HUMAN; Elongation factor 2; Eukaryotic translation elongation factor 2; Polypeptidyl tRNA translocase; SCA26
Target Background
This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.
Notification