Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF2B2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human EIF2B2 (NP_055054.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against EIF2B2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human EIF2B2 (NP_055054.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-02729A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF2B2 |
| Target Synonyms | EIF2B; EIF2Bbeta; EIF-2Bbeta; EIF2B2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human EIF2B2 (NP_055054.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMELIRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE | Uniprot ID | P49770 |
Uniprot Id
P49770
Target Species
Human
Target Name
EIF2B2
Target Full Name
Translation initiation factor eIF2B subunit beta
Target Function
Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Target Involvement
Leukodystrophy with vanishing white matter (VWM)
Target Protein Families
EIF-2B alpha/beta/delta subunits family
Target Research Area
others
Target Synonyms
EI2BB_HUMAN; EIF 2Bbeta; EIF-2Bbeta; EIF2B; EIF2B GDP GTP exchange factor subunit beta; EIF2B2; EIF2B2; EIF2BB; Eukaryotic translation initiation factor 2B; Eukaryotic translation initiation factor 2B beta; Eukaryotic translation initiation factor 2B; subunit 2; Eukaryotic translation initiation factor 2B; subunit 2 beta; Eukaryotic translation initiation factor 2B; subunit 2 beta; 39kDa; S20I15; S20III15; Translation initiation factor eIF-2B subunit beta
Target Background
This gene encodes the beta subunit of eukaryotic initiation factor-2B (EIF2B). EIF2B is involved in protein synthesis and exchanges GDP and GTP for its activation and deactivation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
