-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eIF4E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 118-217 of human eIF4E (P06730) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against eIF4E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 118-217 of human eIF4E (P06730) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-15970A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF4E |
| Target Synonyms | CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1; eIF4E | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse testis, Rat testis | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 118-217 of human eIF4E (P06730). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV | Uniprot ID | P06730 |
Uniprot Id
P06730
Target Species
Human
Target Name
EIF4E
Target Full Name
Eukaryotic translation initiation factor 4E
Target Function
Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. In addition to its role in translation initiation, also acts as a regulator of translation and stability in the cytoplasm. Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression: in the complex, EIF4E mediates the binding to the mRNA cap. Component of a multiprotein complex that sequesters and represses translation of proneurogenic factors during neurogenesis. In P-bodies, component of a complex that mediates the storage of translationally inactive mRNAs in the cytoplasm and prevents their degradation. May play an important role in spermatogenesis through translational regulation of stage-specific mRNAs during germ cell development.
Target Involvement
Autism 19 (AUTS19)
Target Subcellular Location
Cytoplasm, P-body. Cytoplasm. Cytoplasm, Stress granule. Nucleus.
Target Protein Families
Eukaryotic initiation factor 4E family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AUTS19; CBP; eIF 4E; eIF 4F 25 kDa subunit; EIF 4F; eIF-4E; eIF-4F 25 kDa subunit; eIF4E; EIF4E1; EIF4EL1; EIF4F; Eukaryotic translation initiation factor 4 E; Eukaryotic translation initiation factor 4E; Eukaryotic translation initiation factor 4E like 1; IF4E_HUMAN; Messanger RNA Cap Binding Protein eIF 4E ; MGC111573; mRNA cap binding protein; mRNA cap-binding protein
Target Background
The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants.
Notification