-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF4G2/p97 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-490 of human EIF4G2/p97 (NP_001409.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EIF4G2/p97 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-490 of human EIF4G2/p97 (NP_001409.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14915A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF4G2/p97 |
| Target Synonyms | P97; AAG1; DAP5; NAT1; EIF4G2/p97 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 320-490 of human EIF4G2/p97 (NP_001409.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSFLMNKNQVPKL | Uniprot ID | P78344 |
Uniprot Id
P78344
Target Species
Human
Target Name
EIF4G2
Target Full Name
Eukaryotic translation initiation factor 4 gamma 2
Target Function
Appears to play a role in the switch from cap-dependent to IRES-mediated translation during mitosis, apoptosis and viral infection. Cleaved by some caspases and viral proteases.
Target Protein Families
Eukaryotic initiation factor 4G family
Target Tissue Specificity
Ubiquitously expressed in all adult tissues examined, with high levels in skeletal muscle and heart. Also expressed in fetal brain, lung, liver and kidney.
Target Synonyms
DAP-5; DAP5; Death associated protein 5; Death-associated protein 5; eIF-4-gamma 2; eIF-4G 2; eIF4G 2; EIF4G2; Eukaryotic translation initiation factor 4 gamma 2; IF4G2_HUMAN; Nat1; Novel APOBEC-1 target 1; p97; Translation repressor NAT1 ; Translation repressor NAT1
Target Background
Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Notification