Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ELF2 (NP_006865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ELF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ELF2 (NP_006865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09318A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELF2 |
| Target Synonyms | EU32; NERF; NERF-2; NERF-1A; NERF-1B; NERF-1a; b; ELF2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HL-60, Jurkat, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ELF2 (NP_006865.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATSLHEGPTNQLDLLIRAVEASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDVITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKP | Uniprot ID | Q15723 |
Uniprot Id
Q15723
Target Species
Human
Target Name
ELF2
Target Full Name
ETS-related transcription factor Elf-2
Target Function
Isoform 1 transcriptionally activates the LYN and BLK promoters and acts synergistically with RUNX1 to transactivate the BLK promoter.; Isoform 2 may function in repression of RUNX1-mediated transactivation.
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Tissue Specificity
Expressed in all fetal and adult tissues examined. Among fetal tissues, highest levels of expression detected in heart, lung, liver and kidney, and lower levels in brain. Among adult tissues, highest levels of expression detected in heart, placenta, lung,
Target Synonyms
ELF2; NERFETS-related transcription factor Elf-2; E74-like factor 2; New ETS-related factor
Target Background
Enables DNA-binding transcription factor activity, RNA polymerase II-specific and sequence-specific double-stranded DNA binding activity. Involved in negative regulation of transcription, DNA-templated; positive regulation of transcription, DNA-templated; and regulation of transcription by RNA polymerase II. Located in cytosol and nuclear body.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
