Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ETS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human ETS2 (NP_005230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ETS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human ETS2 (NP_005230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03902A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ETS2 |
| Target Synonyms | ETS2IT1; ETS2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ETS2 (NP_005230.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA | Uniprot ID | P15036 |
Uniprot Id
P15036
Target Species
Human
Target Name
ETS2
Target Full Name
Protein C-ets-2
Target Function
Transcription factor activating transcription. Binds specifically the DNA GGAA/T core motif (Ets-binding site or EBS) in gene promoters and stimulates transcription.
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Synonyms
C ets 2 protein; ETS2; ETS2_HUMAN; ETS2IT1; Oncogene ETS 2; Oncogene ETS2; Protein C-ets-2; v ets avian erythroblastosis virus E2 oncogene homolog 2; V ets avian erythroblastosis virus E26 oncogene homolog 2; V ets erythroblastosis virus E26 oncogene homolog 2
Target Background
This gene encodes a transcription factor which regulates genes involved in development and apoptosis. The encoded protein is also a protooncogene and shown to be involved in regulation of telomerase. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
