-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against F7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-400 of human F7 (NP_062562.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against F7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-400 of human F7 (NP_062562.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04676A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | F7 |
| Target Synonyms | SPCA; F7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, LO2, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-400 of human F7 (NP_062562.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTGIV | Uniprot ID | P08709 |
Uniprot Id
P08709
Target Species
Human
Target Name
F7
Target Full Name
Coagulation factor VII
Target Function
Initiates the extrinsic pathway of blood coagulation. Serine protease that circulates in the blood in a zymogen form. Factor VII is converted to factor VIIa by factor Xa, factor XIIa, factor IXa, or thrombin by minor proteolysis. In the presence of tissue factor and calcium ions, factor VIIa then converts factor X to factor Xa by limited proteolysis. Factor VIIa will also convert factor IX to factor IXa in the presence of tissue factor and calcium.
Target Involvement
Factor VII deficiency (FA7D)
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase S1 family
Target Tissue Specificity
Plasma.
Target Research Area
Cardiovascular
Target Synonyms
coagulation factor VII (serum prothrombin conversion accelerator); Coagulation factor VII; Eptacog alfa ; F7; FA7_HUMAN; Factor VII ; Factor VII heavy chain; Factor VII light chain; FVII coagulation protein ; OTTHUMP00000018733; OTTHUMP00000018734; Proconvertin; Serum prothrombin conversion accelerator; SPCA
Target Background
This gene encodes coagulation factor VII which is a vitamin K-dependent factor essential for hemostasis. This factor circulates in the blood in a zymogen form, and is converted to an active form by either factor IXa, factor Xa, factor XIIa, or thrombin by minor proteolysis. Upon activation of the factor VII, a heavy chain containing a catalytic domain and a light chain containing 2 EGF-like domains are generated, and two chains are held together by a disulfide bond. In the presence of factor III and calcium ions, the activated factor then further activates the coagulation cascade by converting factor IX to factor IXa and/or factor X to factor Xa. Defects in this gene can cause coagulopathy. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing to generate mature polypeptides.
Notification