-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FABP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human FABP5 (NP_001435.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against FABP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human FABP5 (NP_001435.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08614A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FABP5 |
| Target Synonyms | EFABP; KFABP; E-FABP; PAFABP; PA-FABP; FABP5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HCT116, Mouse liver, Rat liver, Rat stomach, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human FABP5 (NP_001435.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE | Uniprot ID | Q01469 |
Uniprot Id
Q01469
Target Species
Human
Target Name
FABP5
Target Full Name
Fatty acid-binding protein 5
Target Function
Intracellular carrier for long-chain fatty acids and related active lipids, such as endocannabinoids, that regulate the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors. Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation. May be involved in keratinocyte differentiation.
Target Subcellular Location
Cytoplasm. Nucleus. Cell junction, synapse. Cell junction, synapse, postsynaptic density. Secreted.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Tissue Specificity
Keratinocytes; highly expressed in psoriatic skin. Expressed in brain gray matter.
Target Research Area
Cardiovascular
Target Synonyms
CFABP; Cutaneous fatty acid binding protein; DA11; Differentiation associated lipid binding protein LP2; E-FABP; EFABP; Epidermal-type fatty acid-binding protein; FABP5; FABP5_HUMAN; fatty acid binding protein 5 (psoriasis-associated); Fatty acid binding protein epidermal; Fatty acid-binding protein 5; Fatty acid-binding protein; epidermal; Keratinocyte lipid binding protein; KFABP; Klbp; mal1; PA-FABP; PAFABP; Psoriasis associated fatty acid binding protein homolog; Psoriasis-associated fatty acid-binding protein homolog
Target Background
This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.
Notification