-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FASTK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-549 of human FASTK (NP_006703.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FASTK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-549 of human FASTK (NP_006703.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02704A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FASTK |
| Target Synonyms | FAST; FASTK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 360-549 of human FASTK (NP_006703.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDIVAEGLRQLLGEEKYRQDLTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGLRWGPEGG | Uniprot ID | Q14296 |
Uniprot Id
Q14296
Target Species
Human
Target Name
FASTK
Target Full Name
Fas-activated serine/threonine kinase
Target Function
Phosphorylates the splicing regulator TIA1, thereby promoting the inclusion of FAS exon 6, which leads to an mRNA encoding a pro-apoptotic form of the receptor.; Required for the biogenesis of some mitochondrial-encoded mRNAs, specifically stabilizes ND6 (NADH dehydrogenase complex subunit 6) mRNA, and regulates its levels.
Target Subcellular Location
[Isoform 4]: Mitochondrion matrix.
Target Protein Families
FAST protein kinase family
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
Fas activated serine threonine kinase; Fas-activated serine/threonine kinase; FAST; FAST kinase; FASTK; FASTK_HUMAN; FLJ13079
Target Background
The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined.
Notification