-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FCRL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-190 of human FCRL5 (NP_001182317.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FCRL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-190 of human FCRL5 (NP_001182317.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06026A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FCRL5 |
| Target Synonyms | CD307; FCRH5; IRTA2; BXMAS1; CD307e; PRO820; FCRL5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 16-190 of human FCRL5 (NP_001182317.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFT | Uniprot ID | Q96RD9 |
Uniprot Id
Q96RD9
Target Species
Human
Target Name
FCRL5
Target Full Name
Fc receptor-like protein 5
Target Function
May be involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. May have an immunoregulatory role in marginal zone B-cells.
Target Involvement
A chromosomal aberration involving FCRL5 has been found in cell lines with 1q21 abnormalities derived from Burkitt lymphoma. Duplication dup(1)(q21q32).
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. Expressed in many lymphoma cell lines and on hairy cell leukemia cells. Isoform 1, isoform 3, iso
Target Research Area
Immunology
Target Synonyms
BXMAS1; CD307 antigen; CD307e; Fc receptor homolog 5; Fc receptor like 5; Fc receptor-like protein 5; FcR-like protein 5; FcRH5; FcRL5; FCRL5_HUMAN; Immune receptor translocation-associated protein 2; Immunoglobulin receptor translocation associated gene 2 protein; Immunoglobulin superfamily receptor translocation associated gene 2 protein; IRTA2; UNQ503/PRO820
Target Background
This gene encodes a member of the immunoglobulin receptor superfamily and the Fc-receptor like family. This gene and several other Fc receptor-like gene members are clustered on the long arm of chromosome 1. The encoded protein is a single-pass type I membrane protein and contains 8 immunoglobulin-like C2-type domains. This gene is implicated in B cell development and lymphomagenesis. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification