-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-206 of human FGF4 (NP_001998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FGF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-206 of human FGF4 (NP_001998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05484A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FGF4 |
| Target Synonyms | HST; KFGF; FGF-4; HST-1; HSTF1; K-FGF; HBGF-4; HSTF-1; FGF4 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 31-206 of human FGF4 (NP_001998.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL | Uniprot ID | P08620 |
Uniprot Id
P08620
Target Species
Human
Target Name
FGF4
Target Full Name
Fibroblast growth factor 4
Target Function
Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
Target Subcellular Location
Secreted.
Target Protein Families
Heparin-binding growth factors family
Target Synonyms
FGF-4; Fgf4; FGF4_HUMAN; Fibroblast growth factor 4; fibroblast growth factor 4 splice isoform; HBGF-4; HBGF4; Heparin secretory-transforming protein 1; Heparin-binding growth factor 4; Hst; HST-1; HST1; HSTF-1; HSTF1; Human stomach cancer transforming factor from FGF related oncogene; K FGF; Kaposi Sarcoma Oncogene; KFGF; KS3; Oncogene HST; Transforming protein KS3
Target Background
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway.
Notification