-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against G3BP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 131-330 of human G3BP1 (NP_938405.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against G3BP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 131-330 of human G3BP1 (NP_938405.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11921A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | G3BP1 |
| Target Synonyms | G3BP; HDH-VIII; G3BP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 131-330 of human G3BP1 (NP_938405.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEP | Uniprot ID | Q13283 |
Uniprot Id
Q13283
Target Species
Human
Target Name
G3BP1
Target Full Name
Ras GTPase-activating protein-binding protein 1
Target Function
ATP- and magnesium-dependent helicase that plays an essential role in innate immunity. Participates in the DNA-triggered cGAS/STING pathway by promoting the DNA binding and activation of CGAS. Enhances also DDX58-induced type I interferon production probably by helping DDX58 at sensing pathogenic RNA. In addition, plays an essential role in stress granule formation. Unwinds preferentially partial DNA and RNA duplexes having a 17 bp annealed portion and either a hanging 3' tail or hanging tails at both 5'- and 3'-ends. Unwinds DNA/DNA, RNA/DNA, and RNA/RNA substrates with comparable efficiency. Acts unidirectionally by moving in the 5' to 3' direction along the bound single-stranded DNA. Phosphorylation-dependent sequence-specific endoribonuclease in vitro. Cleaves exclusively between cytosine and adenine and cleaves MYC mRNA preferentially at the 3'-UTR.
Target Subcellular Location
Cytoplasm, cytosol. Perikaryon. Cytoplasm, Stress granule. Nucleus.
Target Tissue Specificity
Ubiquitous.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ATP dependent DNA helicase VIII; ATP-dependent DNA helicase VIII; G3BP; G3BP stress granule assembly factor 1; G3BP-1; G3bp1; G3BP1_HUMAN; GAP binding protein; GAP SH3 domain binding protein 1; GAP SH3 domain-binding protein 1; GTPase activating protein (SH3 domain) binding protein 1; hDH VIII; Human DNA helicase VIII; MGC111040; Ras GTPase activating protein binding protein 1; Ras GTPase activating protein SH3 domain binding protein ; Ras GTPase-activating protein-binding protein 1; RasGAP associated endoribonuclease G3BP
Target Background
This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Notification