-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GADD45A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-165 of human GADD45A (NP_001915.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GADD45A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-165 of human GADD45A (NP_001915.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10727A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GADD45A |
| Target Synonyms | DDIT1; GADD45; GADD45A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-165 of human GADD45A (NP_001915.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER | Uniprot ID | P24522 |
Uniprot Id
P24522
Target Species
Human
Target Name
GADD45A
Target Full Name
Growth arrest and DNA damage-inducible protein GADD45 alpha
Target Function
In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.
Target Subcellular Location
Nucleus.
Target Protein Families
GADD45 family
Target Research Area
Cell Cycle
Target Synonyms
DDIT 1; DDIT-1; DDIT1; DNA damage inducible transcript 1; DNA damage-inducible transcript 1 protein; GA45A_HUMAN; GADD45; GADD45A; Growth arrest and DNA damage inducible 45 alpha ; Growth arrest and DNA damage inducible alpha; Growth arrest and DNA damage-inducible protein GADD45 alpha
Target Background
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification