-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GIMAP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-270 of human GIMAP5 (NP_060854.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GIMAP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-270 of human GIMAP5 (NP_060854.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01130A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GIMAP5 |
| Target Synonyms | IAN4; IAN5; IROD; IAN-5; IMAP3; NCPH2; HIMAP3; IAN4L1; GIMAP5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 190-270 of human GIMAP5 (NP_060854.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYK | Uniprot ID | Q96F15 |
Uniprot Id
Q96F15
Target Species
Human
Target Name
GIMAP5
Target Full Name
GTPase IMAP family member 5
Target Function
Plays a role in T lymphocyte development and the optimal generation of CD4/CD8 double-positive thymocytes. Inhibitor of GSK3A, possibly by sequestering GSK3A in cytoplasmic vesicles and impairing its translocation to the nucleus. Consequently, impairs GSK3A-dependent transcriptional program and regulation of the DNA damage response occurring during T cells proliferation. Required for the survival of peripheral T cells, natural killer (NK) and NK T-cell development and the maintenance of normal liver function. May promote the survival of mature T lymphocytes upon cytokine withdrawal. May regulate Ca(2+) homeostasis by modulating lysosomal Ca(2+) stores, preventing its accumulation in the absence of T cell activation. May play a role in mitochondrial DNA segregation in hematopoietic tissues.
Target Subcellular Location
Lysosome membrane; Single-pass type IV membrane protein. Endosome, multivesicular body membrane; Single-pass type IV membrane protein. Endosome membrane; Single-pass type IV membrane protein.
Target Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, AIG1/Toc34/Toc159-like paraseptin GTPase family, IAN subfamily
Target Tissue Specificity
Widely expressed with high levels in lymph node and spleen. High expression found in T lymphocytes, including CD4 and CD8-positive T-cells, and monocytes. Very low expression levels in B-lymphocytes.
Target Synonyms
FLJ11296; GIMA5_HUMAN; GIMAP 5; GIMAP5; GTPase IMAP family member 5; hIAN5; HIMAP3; IAN 5 ; IAN4; IAN4L1; IAN5; IMAP3; Immune associated nucleotide 4 like 1; Immunity associated nucleotide 4 like 1 protein; Immunity associated protein 3
Target Background
This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes an antiapoptotic protein that functions in T-cell survival. Polymorphisms in this gene are associated with systemic lupus erythematosus. Read-through transcription exists between this gene and the neighboring upstream GIMAP1 (GTPase, IMAP family member 1) gene.
Notification