-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GIRK2(KCNJ6) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GIRK2(NP_002231.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GIRK2(KCNJ6) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GIRK2(NP_002231.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15497A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GIRK2(KCNJ6) |
| Target Synonyms | BIR1; GIRK2; KATP2; KCNJ7; KPLBS; GIRK-2; KATP-2; KIR3.2; hiGIRK2; GIRK2(KCNJ6) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with KCNJ6 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GIRK2(NP_002231.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVY | Uniprot ID | P48051 |
Uniprot Id
P48051
Target Species
Human
Target Name
KCNJ6
Target Full Name
G protein-activated inward rectifier potassium channel 2
Target Function
This potassium channel may be involved in the regulation of insulin secretion by glucose and/or neurotransmitters acting through G-protein-coupled receptors. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
Target Involvement
Keppen-Lubinsky syndrome (KPLBS)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ6 subfamily
Target Tissue Specificity
Most abundant in cerebellum, and to a lesser degree in islets and exocrine pancreas.
Target Synonyms
KCNJ6; GIRK2; KATP2; KCNJ7; G protein-activated inward rectifier potassium channel 2; GIRK-2; BIR1; Inward rectifier K(+ channel Kir3.2; KATP-2; Potassium channel, inwardly rectifying subfamily J member 6
Target Background
This gene encodes a member of the G protein-coupled inwardly-rectifying potassium channel family of inward rectifier potassium channels. This type of potassium channel allows a greater flow of potassium into the cell than out of it. These proteins modulate many physiological processes, including heart rate in cardiac cells and circuit activity in neuronal cells, through G-protein coupled receptor stimulation. Mutations in this gene are associated with Keppen-Lubinsky Syndrome, a rare condition characterized by severe developmental delay, facial dysmorphism, and intellectual disability.
Notification