-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GITR Ligand/TNFSF18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 52-177 of human GITR Ligand/TNFSF18 (NP_005083.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GITR Ligand/TNFSF18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 52-177 of human GITR Ligand/TNFSF18 (NP_005083.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02730A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GITR Ligand/TNFSF18 |
| Target Synonyms | TL6; AITRL; GITRL; TNLG2A; hGITRL; GITR Ligand/TNFSF18 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 52-177 of human GITR Ligand/TNFSF18 (NP_005083.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSE | Uniprot ID | Q9UNG2 |
Uniprot Id
Q9UNG2
Target Species
Human
Target Name
TNFSF18
Target Full Name
Tumor necrosis factor ligand superfamily member 18
Target Function
Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T-cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B. Triggers increased phosphorylation of STAT1 and up-regulates expression of VCAM1 and ICAM1. Promotes leukocyte adhesion to endothelial cells. Regulates migration of monocytes from the splenic reservoir to sites of inflammation.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Protein Families
Tumor necrosis factor family
Target Tissue Specificity
Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
Target Synonyms
Activation inducible TNF related ligand; Activation-inducible TNF-related ligand; AITR ligand; AITRL; GITR ligand; GITRL; Glucocorticoid induced TNF related ligand; Glucocorticoid induced TNFR related protein ligand; Glucocorticoid-induced TNF-related ligand; hGITRL; MGC138237; TL6; TNF18_HUMAN; TNFSF18; TNLG2A; Tumor necrosis factor (ligand) superfamily member 18; Tumor necrosis factor ligand 2A; Tumor necrosis factor ligand superfamily member 18
Target Background
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
Notification